Reducing Physicians' Cognitive Load During Chart Review: A Problem-Oriented Summary of the Patient Electronic Record.

John M. Prager Jennifer J. Liang Ching-Huei Tsou Bharath Dandala Ananya Poddar Venkata Joopudi Diwakar Mahajan John M. Prager Preethi Raghavan Michele Payne Reducing Physicians' Cognitive Load During Chart Review: A Problem-Oriented Summary of the Patient Electronic Record. 2021 AMIA https://knowledge.amia.org/74229-amia-1.4622266/t003-1.4626466/t003-1.4626467/3577437-1.4626630/3576382-1.4626627 conf/amia/2021 db/conf/amia/amia2021.html#LiangTDPJMPRP21

Adam Lally Sugato Bagchi Michael Barborak David W. Buchanan Jennifer Chu-Carroll David A. Ferrucci Michael R. Glass Aditya Kalyanpur Erik T. Mueller J. William Murdock Siddharth Patwardhan John M. Prager WatsonPaths: Scenario-Based Question Answering and Inference over Unstructured Information. 59-76 2017 38 AI Mag. 2 https://doi.org/10.1609/aimag.v38i2.2715 https://www.wikidata.org/entity/Q126086173 db/journals/aim/aim38.html#LallyBBBCFGKMMP17

John M. Prager Jennifer J. Liang Murthy V. Devarakonda SemanticFind: Locating What You Want in a Patient Record, Not Just What You Ask For. 2017 CRI http://knowledge.amia.org/amia-64484-cri2017-1.3520710/t002-1.3521687/t002-1.3521688/a037-1.3521711/a038-1.3521708 conf/cri/2017 db/conf/cri/cri2017.html#PragerLD17

Gerald Tesauro David Gondek Jonathan Lenchner James Fan John M. Prager Analysis of Watson's Strategies for Playing Jeopardy! 2014 abs/1402.0571 CoRR http://arxiv.org/abs/1402.0571 db/journals/corr/corr1402.html#TesauroGLFP14

Gerry Tesauro David Gondek Jonathan Lenchner James Fan John M. Prager Analysis of Watson's Strategies for Playing Jeopardy! 205-251 2013 47 J. Artif. Intell. Res. https://doi.org/10.1613/jair.3834 db/journals/jair/jair47.html#TesauroGLFP13

Elena Filatova John M. Prager Occupation inference through detection and classification of biographical activities. 39-57 2012 76 Data Knowl. Eng. https://doi.org/10.1016/j.datak.2012.04.001 db/journals/dke/dke76.html#FilatovaP12

Adam Lally John M. Prager Michael C. McCord Branimir Boguraev Siddharth Patwardhan James Fan Paul Fodor Jennifer Chu-Carroll Question analysis: How Watson reads a clue. 2 2012 56 IBM J. Res. Dev. 3 https://doi.org/10.1147/JRD.2012.2184637 db/journals/ibmrd/ibmrd56.html#LallyPMBPFFC12

Aditya Kalyanpur Branimir Boguraev Siddharth Patwardhan J. William Murdock Adam Lally Chris Welty John M. Prager Bonaventura Coppola Achille Fokoue-Nkoutche Lei Zhang 0007 Yue Pan Zhaoming Qiu Structured data and inference in DeepQA. 10 2012 56 IBM J. Res. Dev. 3 https://doi.org/10.1147/JRD.2012.2188737 https://www.wikidata.org/entity/Q114613666 db/journals/ibmrd/ibmrd56.html#KalyanpurBPMLWPCFZPQ12

John M. Prager Eric W. Brown 0001 Jennifer Chu-Carroll Special Questions and techniques. 11 2012 56 IBM J. Res. Dev. 3 https://doi.org/10.1147/JRD.2012.2187392 db/journals/ibmrd/ibmrd56.html#PragerBC12

Gerry Tesauro David Gondek Jon Lenchner James Fan John M. Prager Simulation, learning, and optimization techniques in Watson's game strategies. 16 2012 56 IBM J. Res. Dev. 3 https://doi.org/10.1147/JRD.2012.2188931 db/journals/ibmrd/ibmrd56.html#TesauroGLFP12

David A. Ferrucci Eric W. Brown 0001 Jennifer Chu-Carroll James Fan David Gondek Aditya Kalyanpur Adam Lally J. William Murdock Eric Nyberg John M. Prager Nico Schlaefer Christopher A. Welty Building Watson: An Overview of the DeepQA Project. 59-79 2010 31 AI Mag. 3 https://doi.org/10.1609/aimag.v31i3.2303 https://www.wikidata.org/entity/Q61772844 db/journals/aim/aim31.html#FerrucciBCFGKLMNPSW10

Jennifer Chu-Carroll John M. Prager An experimental study of the impact of information extraction accuracy on semantic search performance. 505-514 2007 conf/cikm/2007 CIKM https://doi.org/10.1145/1321440.1321512 db/conf/cikm/cikm2007.html#Chu-CarrollP07 John M. Prager Sarah Luger Jennifer Chu-Carroll Type nanotheories: a framework for term comparison. 701-710 2007 conf/cikm/2007 CIKM https://doi.org/10.1145/1321440.1321538 db/conf/cikm/cikm2007.html#PragerLC07

John M. Prager Open-Domain Question-Answering. 91-231 2006 1 Found. Trends Inf. Retr. 2 https://doi.org/10.1561/1500000001 db/journals/ftir/ftir1.html#Prager06

John M. Prager Pablo Ariel Duboue Jennifer Chu-Carroll Improving QA Accuracy by Question Inversion. 2006 conf/acl/2006 ACL https://aclanthology.org/P06-1135/ https://doi.org/10.3115/1220175.1220310 db/conf/acl/acl2006.html#PragerDC06 Jennifer Chu-Carroll John M. Prager Krzysztof Czuba David A. Ferrucci Pablo Ariel Duboue Semantic search via XML fragments: a high-precision approach to IR. 445-452 2006 conf/sigir/2006 SIGIR https://doi.org/10.1145/1148170.1148247 db/conf/sigir/sigir2006.html#Chu-CarrollPCFD06 Jennifer Chu-Carroll Guillermo A. Averboch Pablo Ariel Duboue David Gondek J. William Murdock John M. Prager Paul Hoffmann Janyce Wiebe IBM in TREC 2006 Enterprise Track. 2006 TREC http://trec.nist.gov/pubs/trec15/papers/ibm-watson.ent.final.pdf conf/trec/2006 db/conf/trec/trec2006.html#Chu-CarrollADGMPHW06 Elena Filatova John M. Prager Tell Me What You Do and I'll Tell You What You Are: Learning Occupation-Related Activities for Biographies. 2005 conf/naacl/2005 HLT/EMNLP https://aclanthology.org/H05-1015/ db/conf/naacl/naacl2005.html#FilatovaP05 113-120 Jennifer Chu-Carroll Pablo Ariel Duboue John M. Prager Krzysztof Czuba IBM's PIQUANT II in TREC 2005. 2005 TREC http://trec.nist.gov/pubs/trec14/papers/ibm.tjwatson.qa.prager.pdf conf/trec/2005 db/conf/trec/trec2005.html#Chu-CarrollDPC05 John M. Prager Jennifer Chu-Carroll Krzysztof Czuba Question Answering Using Constraint Satisfaction: QA-By-Dossier-With-Contraints. 574-581 2004 conf/acl/2004 ACL https://aclanthology.org/P04-1073/ https://doi.org/10.3115/1218955.1219028 db/conf/acl/acl2004.html#PragerCC04 John M. Prager Jennifer Chu-Carroll Krzysztof Czuba A Multi-Agent Approach to Using Redundancy and Reinforcement in Question Answering. 237-252 2004 conf/ndqa/2004 New Directions in Question Answering db/conf/ndqa/ndqa2004.html#PragerCC04 Jennifer Chu-Carroll Krzysztof Czuba John M. Prager Abraham Ittycheriah Sasha Blair-Goldensohn IBM's PIQUANT II in TREC 2004. 2004 TREC http://trec.nist.gov/pubs/trec13/papers/ibm-prager.qa.pdf conf/trec/2004 db/conf/trec/trec2004.html#Chu-CarrollCPIB04

James Allan 0001 Jay Aslam Nicholas J. Belkin Chris Buckley James P. Callan W. Bruce Croft Susan T. Dumais Norbert Fuhr Donna Harman David J. Harper Djoerd Hiemstra Thomas Hofmann 0001 Eduard H. Hovy Wessel Kraaij John D. Lafferty Victor Lavrenko David D. Lewis Liz Liddy R. Manmatha Andrew McCallum Jay M. Ponte John M. Prager Dragomir R. Radev Philip Resnik Stephen E. Robertson Ronald Rosenfeld Salim Roukos Mark Sanderson Richard M. Schwartz Amit Singhal 0001 Alan F. Smeaton Howard R. Turtle Ellen M. Voorhees Ralph M. Weischedel Jinxi Xu ChengXiang Zhai Challenges in information retrieval and language modeling: report of a workshop held at the center for intelligent information retrieval, University of Massachusetts Amherst, September 2002. 31-47 2003 37 SIGIR Forum 1 https://doi.org/10.1145/945546.945549 https://www.wikidata.org/entity/Q121889597 db/journals/sigir/sigir37.html#AllanABBCCDFHHHHHKLLLLMMPPRRRRRSSSSTVWXZ03

Jennifer Chu-Carroll Krzysztof Czuba John M. Prager Abraham Ittycheriah In Question Answering, Two Heads Are Better Than One. 2003 conf/naacl/2003 HLT-NAACL https://aclanthology.org/N03-1004/ db/conf/naacl/naacl2003.html#Chu-CarrollCPI03 Jennifer Chu-Carroll David A. Ferrucci John M. Prager Christopher A. Welty Hybridization in Question Answering Systems. 116-121 2003 conf/ndqa/2003 New Directions in Question Answering db/conf/ndqa/ndqa2003.html#Chu-CarrollFPW03 John M. Prager Jennifer Chu-Carroll Krzysztof Czuba Christopher A. Welty Abraham Ittycheriah Ruchi Mahindru IBM's PIQUANT in TREC2003. 283-292 2003 conf/trec/2003 TREC http://trec.nist.gov/pubs/trec12/papers/ibm-prager.qa.pdf db/conf/trec/trec2003.html#PragerCCWIM03 Jennifer Chu-Carroll John M. Prager Yael Ravin Christian Cesar A Hybrid Approach to Natural Language Web Search. 2002 EMNLP https://aclanthology.org/W02-1024/ https://doi.org/10.3115/1118693.1118717 conf/emnlp/2002 db/conf/emnlp/emnlp2002.html#Chu-CarrollPRC02 180-187 Krzysztof Czuba John M. Prager Jennifer Chu-Carroll A Machine-Learning Approach to Introspection in a Question Answering System. 2002 EMNLP https://aclanthology.org/W02-1034/ https://doi.org/10.3115/1118693.1118727 conf/emnlp/2002 db/conf/emnlp/emnlp2002.html#CzubaPC02 265-272 Jennifer Chu-Carroll John M. Prager Christopher A. Welty Krzysztof Czuba David A. Ferrucci A Multi-Strategy and Multi-Source Approach to Question Answering. 2002 conf/trec/2002 TREC http://trec.nist.gov/pubs/trec11/papers/ibm.prager.pdf db/conf/trec/trec2002.html#Chu-CarrollPWCF02 Dragomir R. Radev Hong Qi Zhiping Zheng Sasha Blair-Goldensohn Zhu Zhang Weiguo Fan John M. Prager Mining the Web for Answers to Natural Language Questions. 143-150 2001 conf/cikm/2001 CIKM db/conf/cikm/cikm2001.html#RadevQZBZFP01 https://doi.org/10.1145/502585.502610 John M. Prager Dragomir R. Radev Krzysztof Czuba Answering What-Is Questions by Virtual Annotation. 2001 HLT https://aclanthology.org/H01-1006/ conf/naacl/2001hlt db/conf/naacl/hlt2001.html#PragerRC01 John M. Prager Jennifer Chu-Carroll Krzysztof Czuba Use of WordNet Hypernyms for Answering What-Is Questions. 2001 conf/trec/2001 TREC http://trec.nist.gov/pubs/trec10/papers/Trec10NotebookPrager.pdf db/conf/trec/trec2001.html#PragerCC01

John M. Prager Linguini: Language Identification for Multilingual Documents. 71-102 2000 16 J. Manag. Inf. Syst. 3 https://doi.org/10.1080/07421222.1999.11518257 db/journals/jmis/jmis16.html#Prager00

Dragomir R. Radev John M. Prager Valerie Samn Ranking suspected answers to natural language questions using predictive annotation. 150-157 2000 conf/anlp/2000 ANLP https://aclanthology.org/A00-1021/ https://doi.org/10.3115/974147.974168 db/conf/anlp/anlp2000.html#RadevPS00 James W. Cooper John M. Prager Anti-Serendipity: Finding Useless Documents and Similar Documents. 2000 conf/hicss/2000 HICSS https://doi.org/10.1109/HICSS.2000.926691 https://doi.ieeecomputersociety.org/10.1109/HICSS.2000.926691 db/conf/hicss/hicss2000.html#CooperP00 John M. Prager Eric W. Brown 0001 Anni Coden Dragomir R. Radev Question-answering by predictive annotation. 184-191 2000 conf/sigir/2000 SIGIR https://doi.org/10.1145/345508.345574 db/conf/sigir/sigir2000.html#PragerBCR00 John M. Prager Eric W. Brown 0001 Dragomir R. Radev Krzysztof Czuba One Search Engine or Two for Question-Answering. 2000 conf/trec/2000 TREC http://trec.nist.gov/pubs/trec9/papers/PragerTrec9notebook.pdf db/conf/trec/trec2000.html#PragerBRC00

Dragomir R. Radev John M. Prager Valerie Samn Ranking suspected answers to natural language questions using predictive annotation https://arxiv.org/abs/cs/0005029 2000 CoRR cs.CL/0005029 db/journals/corr/corr0005.html#cs-CL-0005029

John M. Prager Linguini: Language Identification for Multilingual Documents. 1999 conf/hicss/1999 HICSS https://doi.org/10.1109/HICSS.1999.772689 https://doi.ieeecomputersociety.org/10.1109/HICSS.1999.772689 db/conf/hicss/hicss1999.html#Prager99 John M. Prager Dragomir R. Radev Eric W. Brown 0001 Anni Coden Valerie Samn The Use of Predictive Annotation for Question Answering in TREC8. 1999 conf/trec/1999 TREC http://trec.nist.gov/pubs/trec8/papers/IBMTrec8QA.ps db/conf/trec/trec1999.html#PragerRBCS99

John M. Prager Donna M. Lamberti David L. Gardner Stephen R. Balzac REASON: An Intelligent User Assistant for Interactive Environments. 141-164 1990 29 IBM Syst. J. 1 db/journals/ibmsj/ibmsj29.html#PragerLGB90 https://doi.org/10.1147/sj.291.0141

John M. Prager Michael A. Arbib Computing the optic flow: The MATCH algorithm and prediction. 271-304 1983 24 Comput. Vis. Graph. Image Process. 3 https://doi.org/10.1016/0734-189X(83)90057-9 db/journals/cvgip/cvgip24.html#PragerA83

John M. Prager The Project Automated Librarian. 214-228 1983 22 IBM Syst. J. 3 db/journals/ibmsj/ibmsj22.html#Prager83 https://doi.org/10.1147/sj.223.0214

John M. Prager Extracting and Labeling Boundary Segments in Natural Scenes. 16-27 1980 2 IEEE Trans. Pattern Anal. Mach. Intell. 1 https://doi.org/10.1109/TPAMI.1980.4766966 http://doi.ieeecomputersociety.org/10.1109/TPAMI.1980.4766966 https://www.wikidata.org/entity/Q52766553 db/journals/pami/pami2.html#Prager80

James Allan 0001 Michael A. Arbib Javed A. AslamJay Aslam Guillermo A. Averboch Sugato Bagchi Stephen R. Balzac Michael Barborak Nicholas J. Belkin Sasha Blair-Goldensohn Branimir Boguraev Eric W. Brown 0001 David W. Buchanan Chris Buckley Jamie CallanJames P. Callan Christian Cesar Jennifer Chu-Carroll Anni Coden James W. Cooper Bonaventura Coppola W. Bruce Croft Krzysztof Czuba Bharath Dandala Murthy V. Devarakonda Pablo Ariel Duboue Susan T. Dumais James Fan Weiguo Fan David A. Ferrucci Elena Filatova Paul Fodor Achille FokoueAchille Fokoue-Nkoutche Norbert Fuhr David L. Gardner Michael R. Glass David Gondek Donna K. HarmanDonna Harman David J. Harper Djoerd Hiemstra Paul Hoffmann Thomas Hofmann 0001 Eduard H. Hovy Abraham Ittycheriah Venkata Joopudi Aditya Kalyanpur Wessel Kraaij John D. Lafferty Adam Lally Donna M. Lamberti Victor Lavrenko Jonathan LenchnerJon Lenchner David D. Lewis Jennifer J. Liang Elizabeth D. LiddyLiz Liddy Sarah Luger Diwakar Mahajan Ruchi Mahindru R. Manmatha Andrew McCallum Michael C. McCord Erik T. Mueller J. William Murdock Eric Nyberg Yue Pan Siddharth Patwardhan Michele Payne Ananya Poddar Jay M. Ponte Hong Qi Zhaoming Qiu Dragomir R. Radev Preethi Raghavan Yael Ravin Philip Resnik Stephen E. Robertson Ronald Rosenfeld Salim Roukos Valerie Samn Mark Sanderson Nico Schlaefer Richard M. Schwartz Amit Singhal 0001 Alan F. Smeaton Gerald TesauroGerry Tesauro Ching-Huei Tsou Howard R. Turtle Ellen M. Voorhees Ralph M. Weischedel Christopher A. WeltyChris Welty Janyce Wiebe Jinxi Xu ChengXiang Zhai Lei Zhang 0007 Zhu Zhang Zhiping Zheng